DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and HSD17B1

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001317148.1 Gene:HSD17B1 / 3292 HGNCID:5210 Length:329 Species:Homo sapiens


Alignment Length:261 Identity:67/261 - (25%)
Similarity:108/261 - (41%) Gaps:46/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVISGASSGIGAACARLLV---AAGLQVVGLAR--RTD-RLEQLRQSL---PAEQRMRFHQHKC 63
            |.:|:|.|||||...|..|.   :...:|....|  :|. ||.:..::|   |..    ....:.
Human     5 VVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGS----LETLQL 65

  Fly    64 DVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128
            ||.....|..|.|.:.:  |.:|||:.|||:.|.|.|..:....:.::|..|::|::...:....
Human    66 DVRDSKSVAAARERVTE--GRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLP 128

  Fly   129 SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQG----SKIK 189
            .|:||. :|.::...|..|:.|.   |.::   .|..|||||..:.|.....|:..|    |.|:
Human   129 DMKRRG-SGRVLVTGSVGGLMGL---PFND---VYCASKFALEGLCESLAVLLLPFGVHSLSLIE 186

  Fly   190 TTSINPGWV-----ATEIVPDET---------------KAKLGEVILQADDVAQAVLYALSTPPH 234
            ...::..::     :.|.|.|.|               |....|.....::||:..|.||..|..
Human   187 CGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKP 251

  Fly   235 T 235
            |
Human   252 T 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 67/261 (26%)
NADB_Rossmann 1..243 CDD:304358 67/261 (26%)
HSD17B1NP_001317148.1 NADB_Rossmann 4..262 CDD:304358 67/261 (26%)
adh_short 5..198 CDD:278532 54/205 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.