DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG31937

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:262 Identity:60/262 - (22%)
Similarity:112/262 - (42%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQR-------------- 55
            :.:|..|:|||||||.|.|..|...|:::|..|||.::|||:::...|..|              
  Fly    45 RGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMD 109

  Fly    56 -MRFHQHKCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGS 119
             :...:||          |....:......:|||:||||........::..:....:.:.::...
  Fly   110 MLDLDEHK----------THLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAV 164

  Fly   120 IYCTKLAAS-SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELIN 183
            ::.::|... .:.:....||   :.:|:.:||:.|.|...:   |..:|.||.|.....:.|:  
  Fly   165 VHLSRLVVRYFVEQNGGRGH---IAATSSIAGFSPVPFSPT---YCAAKHALNAYLLSLKVEM-- 221

  Fly   184 QGSKIKTTSINPGWVATEIVPDE-TKAKLGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGE 247
              .|:..:...||.:||:.:.:. |.::.|:|             .|||   ...:::|.:..|:
  Fly   222 --RKLDVSLFAPGPIATDFLQEAFTGSQGGKV-------------GLST---ANQKRMTAQRCGD 268

  Fly   248 YF 249
            .|
  Fly   269 LF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 59/260 (23%)
NADB_Rossmann 1..243 CDD:304358 58/254 (23%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/262 (23%)
adh_short 47..245 CDD:278532 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.