DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG31548

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:107/251 - (42%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACA-------RLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCD 64
            :|.:|:|||||||||.|       ..|...|..|..|.:......::.||.||       ....|
  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPA-------LVVGD 63

  Fly    65 VSQELQVDTAFEWIE--KELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAA 127
            :::|  .||...|.|  ::.|.:|||:|||||:..|.:.....:..:.::.|||....:.|.||.
  Fly    64 IAKE--ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126

  Fly   128 SSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTS 192
            ..:.:.:  |:::.|:|..|:..:      ..:.||..||..:.........||..:|  ::...
  Fly   127 PELVKTK--GNIVNVSSVNGIRSF------PGVLAYNISKMGVDQFTRCVALELAAKG--VRVNC 181

  Fly   193 INPGWVATEI-----VPDETKAKL-------------GEVILQADDVAQAVLYALS 230
            :|||...|.:     :..||..|.             |:|    .:||.|:.:..|
  Fly   182 VNPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDV----KEVAAAIAFLAS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 66/251 (26%)
NADB_Rossmann 1..243 CDD:304358 66/251 (26%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 66/251 (26%)
NADB_Rossmann 3..253 CDD:304358 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.