DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and sni

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:235 Identity:56/235 - (23%)
Similarity:99/235 - (42%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLV---AAGLQVVGLARRTDRLEQLRQSLPAEQRMRFH-----QHKCDVS 66
            :|:|.:.|:|....:.|:   .....:....|..::.::|...  |:.....|     ....|..
  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDL--AKNHSNIHILEIDLRNFDAY 67

  Fly    67 QELQVDTAFEWIEKELGGIDVLINNAGIV-LGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            .:|..|  .|.:.|: .|::||.|||||. ...::..:.::::.:.||||.:..|...|.....:
  Fly    68 DKLVAD--IEGVTKD-QGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLL 129

  Fly   131 RRRQVA--------GHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSK 187
            ::...|        |....:|.:: :.|......|..:.||..||.||.|..:....:|..|  :
  Fly   130 KKAAKANESQPMGVGRAAIINMSS-ILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQ--R 191

  Fly   188 IKTTSINPGWVATEI--------VPD------ETKAKLGE 213
            |...|::||||.|::        ||.      :|.:||||
  Fly   192 IMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 56/235 (24%)
NADB_Rossmann 1..243 CDD:304358 56/235 (24%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 56/235 (24%)
adh_short 4..209 CDD:278532 49/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.