DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG13377

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:273 Identity:58/273 - (21%)
Similarity:107/273 - (39%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAE-----QRMRFHQH 61
            |...:||.:|:.|.:.:|......|...|.:|..      .:::.:.||||:     .::|.:..
  Fly    41 DSHPSRVVLITSADTALGLQLCTHLANKGYRVFA------GMKEAQDSLPAKLLCGWMKIREYSE 99

  Fly    62 ----------KCDVSQELQVDTAFEWIEKELG----GIDVLINNAGIVLGGQLIDMPTKDINNIL 112
                      :.||::|..:..|...|...|.    ||..:||.:|.|..||:.....:...::|
  Fly   100 EPIAGTIIPMRLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHML 164

  Fly   113 QTNLMGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEIC 177
            :||::|::...|.....:  |...|.|:::...:|  |.......:.|.|:..|:.|:....|..
  Fly   165 RTNILGTLRVAKAFVCFL--RPTRGRLLYLGGVSG--GGNARNEGDGLVAFNASRVAVDKCAEEL 225

  Fly   178 RQELINQGSKIKTTSINPGWVATEIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVE---- 238
            |:||...|              ..:|..:|.....|.:.:| .|||.:...:..|.....:    
  Fly   226 RKELHPYG--------------VSVVALDTCGMTAESLYKA-PVAQTMSLVVGAPTQYTADVLSP 275

  Fly   239 ---QITLRAVGEY 248
               .:..||:.:|
  Fly   276 DALHVIERALWDY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 58/273 (21%)
NADB_Rossmann 1..243 CDD:304358 55/266 (21%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 48/223 (22%)
NADB_Rossmann 46..>237 CDD:304358 46/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.