DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Dhrs7c

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001258527.1 Gene:Dhrs7c / 287411 RGDID:1306989 Length:311 Species:Rattus norvegicus


Alignment Length:260 Identity:66/260 - (25%)
Similarity:107/260 - (41%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLP--AEQRMRFHQHKCDVSQ 67
            ||:|.||:.|.||:|..|||:..|.|.::|...:..:.||.|..:|.  |:....|....  |..
  Rat    36 QNKVVVITDALSGLGKECARVFNAGGARLVLCGKNWEGLESLYAALTSVADPSKTFTPKL--VLL 98

  Fly    68 ELQVDTAFEWIEKEL----GGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128
            :|...:..|.:.||:    |.:|:|||||.:.:.|....:..:....|:..|..|.|..||:...
  Rat    99 DLSDISCVEDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITFTKVLLP 163

  Fly   129 SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQEL------------ 181
            :|..|: .|.::.||:.....|.      ....||..||.|:....:..|.|:            
  Rat   164 NMISRR-TGQIVLVNNIQAKFGI------PFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVSP 221

  Fly   182 ------------INQGSKI-------KTTSINPGWVATEIVPDETKAKLGEVILQADDVAQAVLY 227
                        .|.||.|       .|..::|..||.|::  .|..:..:.:..|:.|.:|.::
  Rat   222 TFIRSYQAYPEQRNWGSSICKFFCRKLTYGVHPVEVAEEVM--RTVRRKKQEVFMANPVPKAAVF 284

  Fly   228  227
              Rat   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 66/260 (25%)
NADB_Rossmann 1..243 CDD:304358 66/260 (25%)
Dhrs7cNP_001258527.1 11beta-HSD1_like_SDR_c 35..296 CDD:187593 66/260 (25%)
PRK06181 37..293 CDD:235726 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.