DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:239 Identity:69/239 - (28%)
Similarity:108/239 - (45%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHK-CDVSQE 68
            :|.|.|::||:||:|..|||:..|||.:||...|....||:..:.|......:...|: |.|:.:
  Rat    51 RNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFD 115

  Fly    69 LQVDTAFEWIEKEL----GGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASS 129
            |....|......|:    |.:|:|||||||...|.:.|........:::.|..|.:..||....|
  Rat   116 LADPGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPS 180

  Fly   130 MRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSIN 194
            |..|: .||::.::|..|....      ...:||..||.|..|..:..|.|:  :.|.|:.|.|:
  Rat   181 MVERK-RGHIVAISSIQGKISI------PFRSAYAASKHATQAFFDCLRAEM--KDSDIEVTVIS 236

  Fly   195 PGWVATEI-------------VPDETKAKLGEVILQADDVAQAV 225
            ||::.|.:             ..|:..|:....:..|.|:..||
  Rat   237 PGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAVEVAQDIFDAV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 69/239 (29%)
NADB_Rossmann 1..243 CDD:304358 69/239 (29%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 69/239 (29%)
PRK06181 52..321 CDD:235726 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.