DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and rdh8a

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:205 Identity:59/205 - (28%)
Similarity:94/205 - (45%) Gaps:17/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLV---AAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQE 68
            :|.:|:|.|||||...|.||.   .....|:...|...:.::|.::..............|:..:
Zfish     8 KVVLITGCSSGIGLRIAVLLARDEQKRYHVIATMRDLKKKDRLVEAAGEVYGQTLTLLPLDICSD 72

  Fly    69 LQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMRRR 133
            ..|......::..  .|||||||||:.|.|.:..:...::..:.:||..|::...|.....|::|
Zfish    73 ESVRQCVNSVKDR--HIDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVRMIKEVMPDMKKR 135

  Fly   134 QVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWV 198
            | |||:|.::|..|:.|...:      :.||.||||:....|....:|:.  ..:|.:.|.||.|
Zfish   136 Q-AGHIIIMSSVMGLQGVVFN------DVYTASKFAIEGFCESMAVQLLK--FNVKLSLIEPGPV 191

  Fly   199 ATEIVPDETK 208
            .||.   |||
Zfish   192 HTEF---ETK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 59/205 (29%)
NADB_Rossmann 1..243 CDD:304358 59/205 (29%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 59/205 (29%)
adh_short 8..207 CDD:278532 59/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.