DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Hsd17b6

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001346306.1 Gene:Hsd17b6 / 27400 MGIID:1351670 Length:317 Species:Mus musculus


Alignment Length:287 Identity:67/287 - (23%)
Similarity:114/287 - (39%) Gaps:75/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RW----------QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMR 57
            ||          |::...|:|..||.|...||.|...|::|:.........|:||.    :...|
Mouse    16 RWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRN----KTSDR 76

  Fly    58 FHQHKCDVSQELQVDTAFEWIEKELG--GIDVLINNAGIVLGGQLID-MPTKDINNILQTNLMGS 119
            ......||::...:..|.:|:::.:|  |:..|:||||::.....|: ...:|...|.|.||:| 
Mouse    77 LETVILDVTKTESIVAATQWVKERVGDRGLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIG- 140

  Fly   120 IYCTKLAASSM-RRRQVAGHLIFVNSTAG----VAGYKPDPADESLNAYTPSKFALTAVQEICRQ 179
              .|::..|.: ..::..|.::.|:|..|    ..|:           |:.||:.:.|..::.|.
Mouse   141 --LTQVTISMLFLVKKARGRIVNVSSALGRVALFGGF-----------YSCSKYGVEAFSDVLRH 192

  Fly   180 ELINQGSKIKTTSINPGWVATEI----------------VPDETKAKLGEVILQADD-------- 220
            |:.:.|  :|.:.|.||...||:                .|:..|...|:...  ||        
Mouse   193 EVQDFG--VKVSIIEPGSFKTEMTDAELTIERTKKVWEAAPEHIKESYGQQFF--DDFCSTTKRE 253

  Fly   221 ----------VAQAVLYAL-STPPHTQ 236
                      |...:.:|| ||.|.|:
Mouse   254 LMKCSRNLSLVTDCMEHALTSTHPRTR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 67/287 (23%)
NADB_Rossmann 1..243 CDD:304358 67/287 (23%)
Hsd17b6NP_001346306.1 NADB_Rossmann 30..306 CDD:389744 64/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.