DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and SPAC521.03

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:73/241 - (30%)
Similarity:121/241 - (50%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWQNRVAVISGASSGIGAACA-RLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCD 64
            |.|...:..:|:|||||||.:.| .:...|.::::..|||...:|::.:.|.::..:.....|.|
pombe     1 MSRLDGKTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIAKELESKYEVSVLPLKLD 65

  Fly    65 VSQELQVDTAFEWIEKELGGIDVLINNAGIVLG-GQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128
            ||....:....|.:.||...|||||||||:.|| .::||:...|...::.||::|.:..|: |..
pombe    66 VSDLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMTR-AVL 129

  Fly   129 SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSI 193
            .:...:..|.::.|.|.||...|...      :.|..:|.||.......|:|.|:  ::|:...:
pombe   130 PIFYSKNKGDILNVGSIAGRESYVGG------SVYCSTKSALAQFTSALRKETID--TRIRIMEV 186

  Fly   194 NPGWVATEIV-----PDETKA----KLGEVILQADDVAQAVLYALS 230
            :||.|.||..     .|:.||    |..|. |..:|:|:.:|:||:
pombe   187 DPGLVETEFSVVRFHGDKQKADNVYKNSEP-LTPEDIAEVILFALT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 73/241 (30%)
NADB_Rossmann 1..243 CDD:304358 73/241 (30%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 73/241 (30%)
SDR_c5 7..256 CDD:187604 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.670

Return to query results.
Submit another query.