Sequence 1: | NP_788887.1 | Gene: | CG10962 / 31824 | FlyBaseID: | FBgn0030073 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025461.1 | Gene: | Rdh8 / 235033 | MGIID: | 2685028 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 276 | Identity: | 76/276 - (27%) |
---|---|---|---|
Similarity: | 109/276 - (39%) | Gaps: | 46/276 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QNRVAVISGASSGIGAACARLLV---AAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVS 66
Fly 67 QELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMR 131
Fly 132 RRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPG 196
Fly 197 WVATEI------------VPDETKAKLG---EVILQAD------------DVAQAVLYALST--P 232
Fly 233 P---HTQVEQITLRAV 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10962 | NP_788887.1 | YdfG | 1..249 | CDD:226674 | 76/276 (28%) |
NADB_Rossmann | 1..243 | CDD:304358 | 74/272 (27%) | ||
Rdh8 | NP_001025461.1 | NADB_Rossmann | 6..263 | CDD:304358 | 73/267 (27%) |
adh_short | 6..201 | CDD:278532 | 59/205 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |