DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Rdh8

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:276 Identity:76/276 - (27%)
Similarity:109/276 - (39%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLV---AAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVS 66
            |.|..:|||.|||||...|..|.   ....|||...|...:.|.|..:............:.||.
Mouse     4 QQRTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLGKKEPLEAAAGEALGKTLSVVQLDVC 68

  Fly    67 QELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMR 131
            .:..|......||.  |.:|||:||||:.|.|.|..:....:.::..||..|::...|.....|:
Mouse    69 NDESVTDCLSHIEG--GQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAVLPGMK 131

  Fly   132 RRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPG 196
            ||: .||::.|:|..|:.|...:      :.|..|||||....|....:|  :...|..:.:.||
Mouse   132 RRR-QGHIVVVSSVMGLQGVMFN------DVYAASKFALEGFFESLAIQL--RQFNIFISMVEPG 187

  Fly   197 WVATEI------------VPDETKAKLG---EVILQAD------------DVAQAVLYALST--P 232
            .|.|:.            .||.....||   ::.|.|.            ||||.:...:.|  |
Mouse   188 PVTTDFEGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKVIGTTRP 252

  Fly   233 P---HTQVEQITLRAV 245
            |   .|....:.|.|:
Mouse   253 PLRRQTNTRYLPLTAL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 76/276 (28%)
NADB_Rossmann 1..243 CDD:304358 74/272 (27%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 73/267 (27%)
adh_short 6..201 CDD:278532 59/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.