Sequence 1: | NP_788887.1 | Gene: | CG10962 / 31824 | FlyBaseID: | FBgn0030073 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663403.1 | Gene: | Dhrs7b / 216820 | MGIID: | 2384931 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 63/202 - (31%) |
---|---|---|---|
Similarity: | 102/202 - (50%) | Gaps: | 14/202 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQH---KCDVS 66
Fly 67 QELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTK-LAASSM 130
Fly 131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195
Fly 196 GWVATEI 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10962 | NP_788887.1 | YdfG | 1..249 | CDD:226674 | 63/202 (31%) |
NADB_Rossmann | 1..243 | CDD:304358 | 63/202 (31%) | ||
Dhrs7b | NP_663403.1 | 11beta-HSD1_like_SDR_c | 50..309 | CDD:187593 | 63/202 (31%) |
PRK06181 | 52..319 | CDD:235726 | 63/201 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |