DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:202 Identity:63/202 - (31%)
Similarity:102/202 - (50%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQH---KCDVS 66
            :|.|.|::||:||:|..||::..|||.::|...|....||:|.:.|....:.:.||.   ..|::
Mouse    51 RNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLA 115

  Fly    67 QELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTK-LAASSM 130
            ....:..|...|.:..|.:|||||||||...|.:.|........:::.|..|.:..|| |..|.:
Mouse   116 DPGTIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMV 180

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195
            .|:|  ||::.::|..|....      ...:||:.||.|..|..:..|.|:  :.:.||.|.|:|
Mouse   181 ERKQ--GHIVAISSIQGKISI------PFRSAYSASKHATQAFFDCLRAEM--EEANIKVTVISP 235

  Fly   196 GWVATEI 202
            |::.|.:
Mouse   236 GYIHTNL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 63/202 (31%)
NADB_Rossmann 1..243 CDD:304358 63/202 (31%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 63/202 (31%)
PRK06181 52..319 CDD:235726 63/201 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.