Sequence 1: | NP_788887.1 | Gene: | CG10962 / 31824 | FlyBaseID: | FBgn0030073 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001207422.1 | Gene: | DHRS7C / 201140 | HGNCID: | 32423 | Length: | 312 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 65/260 - (25%) |
---|---|---|---|
Similarity: | 104/260 - (40%) | Gaps: | 47/260 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL-----PAEQRMRFHQHKCD 64
Fly 65 VSQELQV-DTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128
Fly 129 SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTS- 192
Fly 193 ------------------------------INPGWVATEIVPDETKAKLGEVILQADDVAQAVLY 227
Fly 228 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10962 | NP_788887.1 | YdfG | 1..249 | CDD:226674 | 65/260 (25%) |
NADB_Rossmann | 1..243 | CDD:304358 | 65/260 (25%) | ||
DHRS7C | NP_001207422.1 | 11beta-HSD1_like_SDR_c | 35..297 | CDD:187593 | 65/260 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |