DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Dhrs11

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_808232.2 Gene:Dhrs11 / 192970 MGIID:2652816 Length:260 Species:Mus musculus


Alignment Length:257 Identity:93/257 - (36%)
Similarity:146/257 - (56%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFH-----Q 60
            |:||::|:|:::|||.|||||.||.||..||:|||.||....:|:    |.||.:...:     .
Mouse     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEE----LAAECKSAGYPGTLIP 66

  Fly    61 HKCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKL 125
            ::||:|.|..:.:.|..:..:..|:|:.|||||:.....|:...|....::...|::....||:.
Mouse    67 YRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTRE 131

  Fly   126 AASSMRRRQV-AGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIK 189
            |..||:.|.: .||:|.:||   :.|::. |....::.|:.:|:|:||:.|..||||:...:.|:
Mouse   132 AYQSMKERNIDDGHIININS---MCGHRV-PPQSVIHFYSATKYAVTALTEGLRQELLEAQTHIR 192

  Fly   190 TTSINPGWVATEIV-------PDETKAKLGEV-ILQADDVAQAVLYALSTPPHTQVEQITLR 243
            .|.|:||.|.|:..       |.|..|....: .|:.:|||:||:|.||||||.||..|.:|
Mouse   193 ATCISPGLVETQFAFKLHDKDPGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDIQMR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 93/257 (36%)
NADB_Rossmann 1..243 CDD:304358 92/255 (36%)
Dhrs11NP_808232.2 YdfG 6..259 CDD:226674 93/257 (36%)
Mgc4172-like_SDR_c 6..256 CDD:187601 93/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833538
Domainoid 1 1.000 151 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41560
Inparanoid 1 1.050 188 1.000 Inparanoid score I3893
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm42824
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.