DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and R05D8.9

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:214 Identity:60/214 - (28%)
Similarity:100/214 - (46%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL-----PAEQRMRFHQ 60
            :.|:..:||:::|:|:|||.|.|.|....|.:|....|..:|||:.||.:     |       ..
 Worm     2 LSRFSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVP-------ES 59

  Fly    61 HKCDVSQEL-----QVDTAFEWIEKELGGIDVLINNAGIVLG---GQL-IDMPTKDINNILQTNL 116
            |...|:.:|     |.:.....|:| .|.:|:|:||||....   |:: :|......:.|:|.|:
 Worm    60 HVLSVATDLAAEKGQDELVNSTIQK-FGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINM 123

  Fly   117 MGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQEL 181
            ...:..|:.|...:.:.:  |.::.|:|.||.|..:|     .:..|..||.||.........:|
 Worm   124 RSVVTLTQKAKEHLVKAK--GEIVNVSSIAGTAHAQP-----GVMYYAMSKSALDQFTRCAAIDL 181

  Fly   182 INQGSKIKTTSINPGWVAT 200
            |..|  ::..|::||.|.|
 Worm   182 IQYG--VRVNSVSPGGVTT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 60/214 (28%)
NADB_Rossmann 1..243 CDD:304358 60/214 (28%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 60/212 (28%)
NADB_Rossmann 5..266 CDD:304358 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.