DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and F20G2.1

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_506406.1 Gene:F20G2.1 / 184742 WormBaseID:WBGene00008985 Length:249 Species:Caenorhabditis elegans


Alignment Length:237 Identity:60/237 - (25%)
Similarity:102/237 - (43%) Gaps:37/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVA-AGLQ-VVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQVD 72
            :|:||:.|||....:..:. ..:| ::|..|......:|.    :.:..|.|..:.|:..:..:.
 Worm     7 LITGANRGIGLGLLKQFIKNKDVQIIIGTCRDPSNATELN----SIKDTRVHILQLDIDCDDSIR 67

  Fly    73 TAFEWIEKELG--GIDVLINNAGIVLGGQLIDMPTKD-INNILQTNLMGSIYCT-------KLAA 127
            .....:||.:|  |:.||||||||.:...:....::. :...|:||.:.::..|       |.||
 Worm    68 KLGAEVEKLVGEDGLTVLINNAGIFVPYDIDGEKSRSTLIRQLETNTISTVLITQELLPLLKRAA 132

  Fly   128 SSMRRRQVA---GHLIFVNSTAGVAGYKPDPADESLN----AYTPSKFALTAVQEICRQELINQG 185
            :..|....:   ..:|.::||||    .....|.|.|    ||..||.||.:..:.|..:|... 
 Worm   133 AKNRGEGYSINRSAIINISSTAG----SITKIDASYNIPLVAYRMSKSALNSFGKSCSVDLAKY- 192

  Fly   186 SKIKTTSINPGWVATEI--------VPDETKAKLGEVILQAD 219
             .|..|:..||||.|::        :.|.||.....:::..|
 Worm   193 -HILVTTFCPGWVKTDMGGANGKLEIDDATKTLSDNILILGD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 60/237 (25%)
NADB_Rossmann 1..243 CDD:304358 60/237 (25%)
F20G2.1NP_506406.1 adh_short 4..208 CDD:278532 56/210 (27%)
carb_red_sniffer_like_SDR_c 6..248 CDD:187586 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.