DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and D1054.8

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_505755.1 Gene:D1054.8 / 183917 WormBaseID:WBGene00008375 Length:278 Species:Caenorhabditis elegans


Alignment Length:257 Identity:72/257 - (28%)
Similarity:113/257 - (43%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPA----EQRMRFHQH 61
            |.|:..:||:|:|:|:|||.|.|.|....|.:|....|..:|||:.||.:.|    ||.:  :..
 Worm     1 MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNV--NSV 63

  Fly    62 KCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPT----KDINNILQTNLMGSIYC 122
            ..||:.:...|........:.|.:|:|:||||..:........|    :..:..|..||...|..
 Worm    64 VADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIAL 128

  Fly   123 TKLAASSMRRRQVAGHLIFVNSTAGVAGYKPD-P----ADESLNAYTPSKFALTAVQEICRQELI 182
            ||.|...:  ....|.::.::|.|......|| |    |..:::.||.:    ||:      :||
 Worm   129 TKKAVPHL--SSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRN----TAI------DLI 181

  Fly   183 NQGSKIKTTSINPGWVATEI-----VPDETKAKL------------GEVILQADDVAQAVLY 227
            ..|  |:..||:||.|||..     :|:||..|.            ..|:.|..|:|:.:.:
 Worm   182 QHG--IRVNSISPGLVATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEVIAF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 72/257 (28%)
NADB_Rossmann 1..243 CDD:304358 72/257 (28%)
D1054.8NP_505755.1 FabG 3..261 CDD:223959 71/255 (28%)
SDR_c11 4..265 CDD:187622 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.