DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and sdz-8

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_505921.1 Gene:sdz-8 / 183834 WormBaseID:WBGene00008334 Length:250 Species:Caenorhabditis elegans


Alignment Length:218 Identity:52/218 - (23%)
Similarity:92/218 - (42%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVAAG--LQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQVD 72
            |::||:.|||....:.||...  ..::..||..::..:|:    :.:..|.|.....|:.:..:|
 Worm     7 VVTGANRGIGLGLVQQLVKDKNIRHIIATARDVEKATELK----SIKDSRVHVLPLTVTCDKSLD 67

  Fly    73 TAFEWIEKELG--GIDVLINNAGIVLGGQLIDMPTK-------DINN---ILQTNLMGSIYCTKL 125
            |....:.:.:|  |:.:||||||::|.......|.:       |:|.   :|.|..:  :...|.
 Worm    68 TFVSKVGEIVGSDGLSLLINNAGVLLSYGTNTEPNRAVIAEQLDVNTTSVVLLTQKL--LPLLKN 130

  Fly   126 AAS-------SMRRRQV----AGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQ 179
            |||       |:.|..|    :|.....::|:|.|.:       .:.||..||.|:.........
 Worm   131 AASKESGDQLSVSRAAVITISSGLGSITDNTSGSAQF-------PVLAYRMSKAAINMFGRTLAV 188

  Fly   180 ELINQGSKIKTTSINPGWVATEI 202
            :|  :...:...:..||||.|.:
 Worm   189 DL--KDDNVLVVNFCPGWVQTNL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 52/218 (24%)
NADB_Rossmann 1..243 CDD:304358 52/218 (24%)
sdz-8NP_505921.1 carb_red_sniffer_like_SDR_c 6..250 CDD:187586 52/218 (24%)
adh_short 6..212 CDD:278532 52/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.