powered by:
Protein Alignment CG10962 and C33E10.10
DIOPT Version :9
Sequence 1: | NP_788887.1 |
Gene: | CG10962 / 31824 |
FlyBaseID: | FBgn0030073 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_510806.1 |
Gene: | C33E10.10 / 183165 |
WormBaseID: | WBGene00016350 |
Length: | 135 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 15/58 - (25%) |
Similarity: | 24/58 - (41%) |
Gaps: | 9/58 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 AYTPSKFALTAVQEICRQELINQGSKIKTTS-INPGWVATEI--------VPDETKAK 210
:|:.||.||....:..|.|..|....:.:.. ||.|:.:..: |.||.:.|
Worm 15 SYSASKHALQGYFDCLRAEHKNLHILVVSAGYINTGFGSRALNTDGKVVGVEDENQKK 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1205 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.