DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhs-26

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_508580.2 Gene:dhs-26 / 180624 WormBaseID:WBGene00000989 Length:321 Species:Caenorhabditis elegans


Alignment Length:237 Identity:62/237 - (26%)
Similarity:93/237 - (39%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAG--LQVVGLARRTDRLEQLRQSLPA------EQRMR---F 58
            ::::|:::|||.|.|...|..|..||  |.:.|.|.......:|.. ||.      |.|.|   .
 Worm     4 KSKIAIVTGASRGCGRGVALQLAEAGCTLYITGRAPSKTLSSELTY-LPTLEGTAEECRKRGGIC 67

  Fly    59 HQHKCDVSQELQVDTAFEWIEKELGG-IDVLINNAGIVLGGQLIDMPTK---------------- 106
            |....|.|...:|:..|:.:..|... :|:|:|||        ....||                
 Worm    68 HVRYVDHSNMDEVEKFFDEVASETDNQLDILVNNA--------FSAVTKCGSGDTRKFFERDPEI 124

  Fly   107 --DINNILQTNLMGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFA 169
              ||||:   .|....||:......||:..:.|.::.::|..|:...       ...||...|.|
 Worm   125 WDDINNV---GLRNQYYCSVYGTRIMRKNGMKGLIVNISSLGGIMYL-------FTVAYGVGKMA 179

  Fly   170 LTAVQEICRQELINQGSKIKTTSINPGWVATEIVPD--ETKA 209
            |..:.....|||  |.:.|...|:.|..|.||::.:  ||.|
 Worm   180 LDRMSSDMAQEL--QDTGITVISLWPSAVKTELITNMIETSA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 62/237 (26%)
NADB_Rossmann 1..243 CDD:304358 62/237 (26%)
dhs-26NP_508580.2 PRK08303 1..286 CDD:236229 62/237 (26%)
DHRS1-like_SDR_c 3..278 CDD:187664 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.