DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhs-12

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_501850.1 Gene:dhs-12 / 177888 WormBaseID:WBGene00000975 Length:255 Species:Caenorhabditis elegans


Alignment Length:264 Identity:68/264 - (25%)
Similarity:117/264 - (44%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISGASSGIGAACAR-LLVAAGLQ-VVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQVDT 73
            |:||:.|||....| ||...|:: :|..||..|..::| ||| |:...|.|....|||.:..::.
 Worm     8 ITGANRGIGLGLVRELLKVPGVEALVAGARNIDGAKEL-QSL-AKADARLHLIAVDVSNDGSLEN 70

  Fly    74 AFEWIEKELG--GIDVLINNAGIVLGGQLIDMPTK-------DINNILQTNLMGSIYCTKLAASS 129
            :.:.:...:|  |:::||||||::........|.:       |:|.:  :.|:.|.:...|.   
 Worm    71 SVKSVSGIVGDRGLNLLINNAGLIESYGTTSAPNRASVLHCIDVNAV--SALLASQHFLPLL--- 130

  Fly   130 MRRRQVAGHLIFVNST---AGVAGYKPDPADESLN-----------AYTPSKFALTAVQEICRQE 180
               ::.|.|:...:.|   |.:.....|.|.::||           ||..||.|:.:.......:
 Worm   131 ---QKAASHVSGDSLTPDRAAIVNIGSDCASQALNLRGSGPSNSLLAYKMSKVAMLSFSRSMAAD 192

  Fly   181 LINQGSKIKTTSINPGWVAT-------EIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVE 238
            .......:..|:|:||||.|       ||..||:..|:...|.:.:...|..|:      :.::|
 Worm   193 FKRLEIPVLITNIHPGWVQTDMGGSNAEISVDESVTKIVASIAKLNGGHQGGLF------NRELE 251

  Fly   239 QITL 242
            ::.|
 Worm   252 EMPL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/264 (26%)
NADB_Rossmann 1..243 CDD:304358 68/264 (26%)
dhs-12NP_501850.1 adh_short 4..217 CDD:278532 58/218 (27%)
carb_red_sniffer_like_SDR_c 6..254 CDD:187586 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.