DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and H04M03.3

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_500885.1 Gene:H04M03.3 / 177359 WormBaseID:WBGene00019153 Length:333 Species:Caenorhabditis elegans


Alignment Length:241 Identity:51/241 - (21%)
Similarity:89/241 - (36%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQ-------------- 54
            |....|..|..|:...:|.:|:|:..|...:|        .:....|.|||              
 Worm    31 WFKTTATTSFVSTARCSAMSRVLITGGTDGIG--------REAALKLAAEQHEITISGRDPNKAK 87

  Fly    55 ------RMRFHQH----KCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDIN 109
                  :|:|:..    :.|:|.|.:|......:.:|  ..|:.|.|||::  ........:|..
 Worm    88 DVIGQCQMKFNNTPRFIQTDLSLEHEVIKFASQVAEE--QFDICILNAGVM--NPKPGRTREDRE 148

  Fly   110 NILQTNLMGSIYCTKLAASSMRRRQVAGHLIFVNS---------TAGVAGYKPDPADESLNAYTP 165
            ..:.|||:.|.........|.|..|.:.|.:|..|         ..|:..:.|:...:...:..|
 Worm   149 ATMMTNLVSSYMIAHKIIDSRRDDQRSLHFVFSTSILVKFHNATPLGIRFFNPEKVTDWQKSLVP 213

  Fly   166 S------KFALTAVQEICRQELINQGS--KIKTTSINPGWVATEIV 203
            :      |:|::.:........|:|.:  .|..||::||.|.|.|:
 Worm   214 TDVSGAGKYAISKIGLATLSTSISQCNLPNITATSVHPGTVYTNIM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 51/241 (21%)
NADB_Rossmann 1..243 CDD:304358 51/241 (21%)
H04M03.3NP_500885.1 NADB_Rossmann 51..294 CDD:304358 46/221 (21%)
adh_short 52..264 CDD:278532 45/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.