DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:240 Identity:55/240 - (22%)
Similarity:87/240 - (36%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQEL 69
            |.:..:::|||.|||...|..|...|..||..||..:.|:::                  ||:.|
Mouse    45 QGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKV------------------VSRCL 91

  Fly    70 QV-------------DTAF--EWIEKE---LGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNL 116
            ::             |..|  ::|.|.   :||:|:||.|........|.......:..:::.|.
Mouse    92 ELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNF 156

  Fly   117 MGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQEL 181
            :.  |.....|:....:|..|.:..::|.||      ......:..|:.|||||.......|.||
Mouse   157 LS--YVVMSTAALPMLKQSNGSIAVISSLAG------KMTQPMIAPYSASKFALDGFFSTIRTEL 213

  Fly   182 INQGSKIKTTSINPGWVATEIVPDETKAKLGEVILQADDVAQAVL 226
            ......:..|....|.:.||....|..   |.:..||....:..|
Mouse   214 YITKVNVSITLCVLGLIDTETAMKEIS---GIINAQASPKEECAL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 55/240 (23%)
NADB_Rossmann 1..243 CDD:304358 55/240 (23%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.