DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and AgaP_AGAP010696

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_311411.3 Gene:AgaP_AGAP010696 / 1272498 VectorBaseID:AGAP010696 Length:294 Species:Anopheles gambiae


Alignment Length:252 Identity:65/252 - (25%)
Similarity:105/252 - (41%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQEL 69
            :.:|..|:|||||||...|..|...|:::...||....|.:::|:..|:.......:...|   |
Mosquito    46 RGKVVWITGASSGIGRDLAIALARQGVKLCISARNISELLKVKQACIAQSNGSLGPNDVYV---L 107

  Fly    70 QVDTA--------FEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLA 126
            ::|..        |..:......:|:|:||||.....:...:..|....:.:.::...|..:::|
Mosquito   108 EMDMLHLNHHNDYFNMVLDHFKTVDILVNNAGRSQRAEWGSINIKVDRELFELDVFAVINLSRVA 172

  Fly   127 ASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTT 191
            .:...|..:.|||:..:||||:.|     |..| ..||.:|.||....|..|.|..|    :..|
Mosquito   173 LNFFARNSMKGHLVVTSSTAGLIG-----APNS-GTYTGAKHALHGYFEALRNEYPN----VHVT 227

  Fly   192 SINPGWVAT----EIVPDETKAKLGEVILQADDVAQAV----LYALSTPPHTQVEQI 240
            ...||..||    |...|...||..:.:...|....:.    ||||:....|.:..:
Mosquito   228 MFCPGPTATNFLQECFTDTPGAKYNQTVQPTDRRMTSERCGHLYALAIANKTHLSWV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 65/252 (26%)
NADB_Rossmann 1..243 CDD:304358 65/252 (26%)
AgaP_AGAP010696XP_311411.3 NADB_Rossmann 45..294 CDD:304358 65/252 (26%)
adh_short 48..245 CDD:278532 56/209 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.