DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and AgaP_AGAP012514

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_307645.4 Gene:AgaP_AGAP012514 / 1269063 VectorBaseID:AGAP012514 Length:291 Species:Anopheles gambiae


Alignment Length:274 Identity:62/274 - (22%)
Similarity:96/274 - (35%) Gaps:81/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQL---------------RQSLPAEQRMRFHQ 60
            |:|||.|||.|.|......|..:|..|:..:...:|               .::||         
Mosquito    21 ITGASRGIGKAIALKAARDGANIVLAAKTAEPHPKLPGTIYTAAAEIEAAGGKALP--------- 76

  Fly    61 HKC--DVSQELQVDTAFEWIEKELGGIDVLINNAGIV--LGGQLIDMPTKDI-NNILQTNLMGSI 120
              |  ||..|..|..|.:...:..||||:::|||..:  ...:..||...|: :||   |..|:.
Mosquito    77 --CVVDVRSEEAVRAAVQKAVQTFGGIDIVVNNASAISLTPTEETDMKRYDLMHNI---NTRGTF 136

  Fly   121 YCTKLAASSMRRRQVA-----------------GHLIFVNSTAG----VAGYKPD--PADESLNA 162
            ..:|.....:|:.:.|                 .|:.:..:..|    |.|...:  .|:.|:||
Mosquito   137 LVSKECLPYLRKSKHAHILNISPPLNMEPHWFSNHVAYTMAKYGMSMCVLGMAREYASANISVNA 201

  Fly   163 YTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVATEIVPDETKAKL-------------GEV 214
            ..|.....||..|:.      .|.:....|..|     ||:.|...|.|             .:.
Mosquito   202 LWPRTIIYTAAVEML------HGQEGYPFSRKP-----EIMADAAYAILCRSAGSSTGNFFIDDE 255

  Fly   215 ILQADDVAQAVLYA 228
            :|.|:.:.....||
Mosquito   256 VLAAEGITDMAQYA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 62/274 (23%)
NADB_Rossmann 1..243 CDD:304358 62/274 (23%)
AgaP_AGAP012514XP_307645.4 FabG 13..246 CDD:223959 58/249 (23%)
PRK08278 14..284 CDD:181349 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.