DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and rasl11a

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002941581.1 Gene:rasl11a / 100494021 XenbaseID:XB-GENE-876795 Length:239 Species:Xenopus tropicalis


Alignment Length:91 Identity:22/91 - (24%)
Similarity:45/91 - (49%) Gaps:14/91 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HQHKCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQL----IDMPT----KDINNILQTN 115
            :||...|..:.:|.......:.:|..:..:.::|||.|..:|    :::.|    :|:.::.| :
 Frog   124 YQHIRKVHSDSKVPVIVVANKGDLLHVREVSHDAGIQLANELGCSFVEISTSESCQDVCDVFQ-H 187

  Fly   116 LMGSIYCTKL-AASSMRRRQVAGHLI 140
            |...|  ||| :|:...:|:  |.:|
 Frog   188 LCKEI--TKLQSANPAEKRR--GSII 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 22/91 (24%)
NADB_Rossmann 1..243 CDD:304358 22/91 (24%)
rasl11aXP_002941581.1 RERG_RasL11_like 28..194 CDD:206713 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.