powered by:
Protein Alignment CG10962 and hmgcs1
DIOPT Version :9
Sequence 1: | NP_788887.1 |
Gene: | CG10962 / 31824 |
FlyBaseID: | FBgn0030073 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120172.1 |
Gene: | hmgcs1 / 100145212 |
XenbaseID: | XB-GENE-942074 |
Length: | 520 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 28/64 - (43%) |
Gaps: | 12/64 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 ESLNAYTPSKFALTA--VQEICRQELINQGSKIKTTSINPGWVAT--------EIVPDETKAKL 211
|:.|.||||.:...| :.:...|:| .|.:|...|...|:.|| :.:|..:..||
Frog 341 ENGNMYTPSVYGCLASVLAQYSPQQL--AGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKL 402
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1205 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.