DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhrs7c

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_012826975.2 Gene:dhrs7c / 100135266 XenbaseID:XB-GENE-5956201 Length:704 Species:Xenopus tropicalis


Alignment Length:198 Identity:54/198 - (27%)
Similarity:95/198 - (47%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL--PAEQRMRFHQH--KCDV 65
            :|:|.||:.|.||:|..|:|:..:||.::|...:..::||.|..:|  .|:..:.|...  ..|:
 Frog    36 KNKVVVITDAISGLGKECSRVFHSAGARLVLCGKTWEKLEALHDALISVADPSVTFTPKLVLLDI 100

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            |....::...:.|:...|.:|||||||.:.:.|.|..:..:....|:..|..|.|...|.....|
 Frog   101 SDINNMEAMGKEIQDCYGCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHM 165

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195
            ..|: .|.::.||:..|..|. |..|     ||..||.|:....:..|.|:  :...:..::::|
 Frog   166 ISRR-TGQIVLVNTIQGKIGV-PFRA-----AYAASKHAIQGFFDCLRAEV--EEFDVSVSTVSP 221

  Fly   196 GWV 198
            .::
 Frog   222 TFI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 54/198 (27%)
NADB_Rossmann 1..243 CDD:304358 54/198 (27%)
dhrs7cXP_012826975.2 11beta-HSD1_like_SDR_c 35..257 CDD:187593 54/198 (27%)
LAP2alpha 425..629 CDD:371604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.