DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and XB1000829

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001096251.1 Gene:XB1000829 / 100124812 XenbaseID:XB-GENE-1000830 Length:323 Species:Xenopus tropicalis


Alignment Length:267 Identity:68/267 - (25%)
Similarity:110/267 - (41%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACA---------RLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHK 62
            :..:|:|.|||||.|.|         |..|.|.::  .||::.|.:......|.....::    :
 Frog     4 KTVLITGCSSGIGLAIATKLARDEQKRFKVYATMR--NLAKQDDLIAATEGYLGKTMEIK----E 62

  Fly    63 CDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAA 127
            .||..|..:......|...  .||:|::|||:.|.|.:.....:::..::.||..|.:...|...
 Frog    63 MDVCCEDSIRNCVSSIPDR--HIDILVSNAGVGLIGPIECQTIEEMKTVMDTNFFGLVRLLKETL 125

  Fly   128 SSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIK--T 190
            ..|:||: :||::.::|..|:.|...:      :.|..|||   ||:..| :.|..|..|.|  .
 Frog   126 PDMKRRK-SGHIVIISSVMGIQGILFN------DVYAASKF---AVEGFC-ESLAIQALKFKLHL 179

  Fly   191 TSINPGWVATE----IVPDETKAKLG------------------EVILQ-----ADDVAQAVLYA 228
            :.|.||.|.||    :..|..|..|.                  :.|.|     |:|||:..:..
 Frog   180 SLIEPGPVVTEFERKVFEDGMKMDLSAADKETADMFTNIYLKNYKSIFQSLGQTAEDVAEHTMKI 244

  Fly   229 L--STPP 233
            :  ..||
 Frog   245 MLSENPP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/267 (25%)
NADB_Rossmann 1..243 CDD:304358 68/267 (25%)
XB1000829NP_001096251.1 type1_17beta-HSD-like_SDR_c 4..261 CDD:187666 68/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.