DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and Proz

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:117 Identity:26/117 - (22%)
Similarity:55/117 - (47%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PYQAEVI-IDGTAICSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHP 102
            |:|..:. .:|...|:|.::..|.::|.|.|...:.:|.|:.....|        :.:.....|.
Mouse   194 PWQVRLTNSEGEDFCAGVLLQEDFVLTTAKCSLLHSNISVKANVDQR--------IRIKSTHVHM 250

  Fly   103 QYNCWRFDNNLALLKLCDPLKTSEAIQPISIAEDEPDD-----GSWCTVSGW 149
            :|:....:|:::||:|.:||:...:..|:.:.|.:..:     |:...:|||
Mouse   251 RYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLIPGTEGLLSGW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 26/117 (22%)
DUF5585 284..>552 CDD:465521
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:464251
Trypsin 192..>340 CDD:459667 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.