DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and CG34130

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:256 Identity:45/256 - (17%)
Similarity:94/256 - (36%) Gaps:83/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSY----GSIEVRVGTS---- 82
            |..||:.|     |:...::...|.:|..:.:::...:|:|:|:.|:    .|:.|.:.:|    
  Fly    48 RTSGGHAV-----PWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQ 107

  Fly    83 -------------------SRDYDGTGFLLEVC--EIINHPQYNCWRFDNNLALLKLC-DPLKTS 125
                               |:|:...|..::|.  |:.|..:.|    .||  .:.|| :||.:.
  Fly   108 DNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGN----RNN--YVTLCTNPLSSY 166

  Fly   126 EAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLP-DYLQMAWVSVYNREQCAADRGV 189
            :::..:|                              :|:.| :.::...:.|.||..|.:..|.
  Fly   167 KSLSVVS------------------------------YGAGPAENVRTEEIEVLNRMICDSAYGN 201

  Fly   190 WFGLWDNGISYLTLCT--HNGAGGCSYDTGAPLVIDGQLVGILS-EGGC--TTKPDVYANV 245
            :.      :.....|.  ...:..|.:..|.|:....||.||:: ...|  :..|.::.::
  Fly   202 FL------LRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 45/256 (18%)
DUF5585 284..>552 CDD:465521
CG34130NP_001036759.1 Trypsin 53..263 CDD:459667 42/251 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.