DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and intr

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:237 Identity:48/237 - (20%)
Similarity:80/237 - (33%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DAP-----YQAEVIIDGTAICSGAIITSDTIITAASCV---------QSYGSIEVRVGTSSRDYD 87
            :||     :...::.:...|||||:|::..::|:|.|.         :||.....|    ||.|.
  Fly    93 EAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASR----SRIYS 153

  Fly    88 GTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAED--EPDDGSWCTVSGWG 150
            ....:....|              ::|||.|..||: ...:.||.:.|.  ..:|.....:|   
  Fly   154 VANLITGAIE--------------DMALLLLHAPLE-DPFVHPIDLCESPLRRNDNVTMYMS--- 200

  Fly   151 STSWWGSWWDRCFGSLPDYLQMAWVSVYNREQC----AADRGVWFGLWDNGISYLTLC--THNGA 209
                            ..:|:.....:.....|    |.|...:       |:...||  ..|..
  Fly   201 ----------------QQHLRFLRTKLIPNSNCKRSYAQDENAF-------ITQTMLCALNSNRL 242

  Fly   210 GGCSYDTGAPLVIDGQLVGI------LSEGGCTTKPDVYANV 245
            ..|....|..|:...:|.|:      .|:||  ...::||:|
  Fly   243 VDCQTAKGDVLLHQDRLCGVDIYGQHCSDGG--VNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 48/237 (20%)
DUF5585 284..>552 CDD:465521
intrNP_651633.1 Tryp_SPc 112..284 CDD:473915 46/218 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.