DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and CG12951

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:245 Identity:65/245 - (26%)
Similarity:113/245 - (46%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRIIGGYDVDIEDAPYQAEV-IIDGTAICSGAIITSDTIITAASCV--QSYGSIEVRVGTSSRDY 86
            ||::.|.|..:...|:...: ..||:..|.|:||:...::|||.|.  :...::.::.|.::...
  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92

  Fly    87 DGTGFLLEVCEIINHPQYNCWRFD-NNLALLKLCDPLK-TSEAIQPISI-----AEDEPDDGSWC 144
            .|.. ::.:.:||.|..::..|.: |:::||.:.:|.: ...::.|:.:     |..:.|.|...
  Fly    93 MGPN-VVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEG 156

  Fly   145 TVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGA 209
            .:.|||...        .:||:.|.||...:.:|:.|:|.:...   |..|............|.
  Fly   157 VLIGWGLND--------TYGSVQDTLQEVSLKIYSDEECTSRHN---GQTDPKYHICGGVDEGGK 210

  Fly   210 GGCSYDTGAPLVIDGQLVGILSEG--GCTTK--PDVYANVPWFTGWIAEN 255
            |.||.|:|.||:.:||.|||:|..  .||..  |.||..|..:..||..|
  Fly   211 GQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 61/239 (26%)
DUF5585 284..>552 CDD:465521
CG12951NP_649880.1 Tryp_SPc 30..260 CDD:238113 62/241 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.