DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and etaTry

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:121/271 - (44%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVII----------DGTAICSGAIITSDT 61
            ||||.......:.|    .||:||.|.    :.|..:.::          .....|.|.|:.:.|
  Fly    12 LFLLGIYAVSAQSD----GRIVGGADT----SSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68

  Fly    62 IITAASCV--QSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPL-- 122
            |.|||.||  :...:..|..|..||. ...|.::.|.::|.|..||....||::||:.:..||  
  Fly    69 IATAAHCVYNREAENFLVVAGDDSRG-GMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132

  Fly   123 ---KTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCA 184
               .|.|||:   ||.::|..|...|:||||.|        :..|...|.||...|.:.:.|:| 
  Fly   133 DSFSTMEAIE---IASEQPAVGVQATISGWGYT--------KENGLSSDQLQQVKVPIVDSEKC- 185

  Fly   185 ADRGVWFGLWDNGISYLTLCTHNGAGG---CSYDTGAPLVIDGQLVGILSEG-GCT--TKPDVYA 243
            .:...|     ..||...||.....||   |..|:|.|||:..:|.||:|.| ||.  ..|.|||
  Fly   186 QEAYYW-----RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYA 245

  Fly   244 NVPWFTGWIAE 254
            ||.::..|||:
  Fly   246 NVAYYKDWIAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 79/248 (32%)
DUF5585 284..>552 CDD:465521
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/248 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.