DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and CG11911

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:97/247 - (39%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGYDVDIEDAPY---QAEVIIDGTAICSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYDG 88
            :|.|.:.:...|||   .|...:..:.||.|.:|..|.|:|||.|:.....:.:..|..:|    
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTR---- 97

  Fly    89 TGFLLEVCEIINHPQYNCWRFDN---------NLALLKLCDPLKTSEAIQPISIAEDEPDDGSWC 144
                .||.|:....|.:..|...         ::|||.:.:....:|.:||.::...|.......
  Fly    98 ----AEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGET 158

  Fly   145 TVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGA 209
            .:.|||....:       ..|....||.....:.|.|:|..:......:.::.|...:|  ....
  Fly   159 HLYGWGQPKSY-------IFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSL--QQSK 214

  Fly   210 GGCSYDTGAPLVID-----GQLVGILSEG----GCTTKPDVYANVPWFTGWI 252
            ..|:.|:|.|||::     .:|:||:|.|    |....|.:|..|..:..||
  Fly   215 SACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 56/245 (23%)
DUF5585 284..>552 CDD:465521
CG11911NP_608518.1 Tryp_SPc 37..266 CDD:214473 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.