DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and AT4G22310

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_193962.1 Gene:AT4G22310 / 828326 AraportID:AT4G22310 Length:108 Species:Arabidopsis thaliana


Alignment Length:77 Identity:38/77 - (49%)
Similarity:57/77 - (74%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITP 91
            :|.:|..||||:|:.||||.|||.:.:|.::| .::||..:|..|..::..||:||||||:||.|
plant     6 LQAIWNHPAGPKTIHFWAPTFKWGISIANIAD-FAKPPEKLSYPQQIAVTCTGVIWSRYSMVINP 69

  Fly    92 KNYNLLAVNIAV 103
            ||:||.:||:|:
plant    70 KNWNLFSVNVAM 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 38/77 (49%)
AT4G22310NP_193962.1 MPC 5..108 CDD:397629 38/77 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2184
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2090
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm1127
orthoMCL 1 0.900 - - OOG6_101975
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.