DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and AT4G14695

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_567439.1 Gene:AT4G14695 / 827120 AraportID:AT4G14695 Length:109 Species:Arabidopsis thaliana


Alignment Length:91 Identity:40/91 - (43%)
Similarity:61/91 - (67%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITP 91
            :|.||..||||:|:.||||.|||.:.:|.::| ..:||.|||..|..::..||:||.|.|.:|||
plant     6 LQALWNHPAGPKTIHFWAPTFKWGISIANIAD-FQKPPENISYLQQIAVTCTGMIWCRCSTIITP 69

  Fly    92 KNYNLLAVNIAVFLIQGYLMVKHLRW 117
            ||:||.:||:|:.....|.:.:.:::
plant    70 KNWNLFSVNVAMAATGIYQLTRKIKY 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 40/91 (44%)
AT4G14695NP_567439.1 MPC 5..108 CDD:427425 40/91 (44%)

Return to query results.
Submit another query.