DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc2

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001016695.1 Gene:mpc2 / 549449 XenbaseID:XB-GENE-5802002 Length:132 Species:Xenopus tropicalis


Alignment Length:120 Identity:53/120 - (44%)
Similarity:74/120 - (61%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPA 65
            |:...| |...|:..:..|:..:|..::||:..||||:|||||||..||.||:|||:| ::||..
 Frog     1 MAAAVG-LRATYHRALDRIEMMLPSKLRPLYNHPAGPKTVFFWAPIMKWGLVIAGLAD-MTRPAE 63

  Fly    66 NISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSE 120
            .:|..|...|..|||||||||:||.|||::|.|||..|....|..:.:..|:..:
 Frog    64 KLSTGQSAVLTATGLIWSRYSLVIIPKNWSLFAVNFFVGCAGGSQLFRIWRYNQD 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 47/95 (49%)
mpc2NP_001016695.1 MPC 25..131 CDD:367595 47/95 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.