DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc2a

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001004662.1 Gene:mpc2a / 447924 ZFINID:ZDB-GENE-040912-107 Length:109 Species:Danio rerio


Alignment Length:98 Identity:46/98 - (46%)
Similarity:65/98 - (66%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSV 87
            :|..::|::..||||:|||||||.|||.||.||.|| ::|||..:|::|...:..||||||||.:
Zfish     2 LPPKLRPVYNHPAGPKTVFFWAPVFKWGLVAAGFSD-MTRPPEKLSVSQSCVITATGLIWSRYCL 65

  Fly    88 VITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSE 120
            ||.|||:.|.|||..:.:.....:.:..|:..|
Zfish    66 VIIPKNWALFAVNFFLGMCGSIQLFRIWRYNQE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/95 (47%)
mpc2aNP_001004662.1 MPC 11..108 CDD:281629 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.