DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc1

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001002398.2 Gene:mpc1 / 436671 ZFINID:ZDB-GENE-040718-94 Length:109 Species:Danio rerio


Alignment Length:76 Identity:24/76 - (31%)
Similarity:39/76 - (51%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLLA---VNIAV 103
            ||.|...|.|.:|.:|| :.:.|..||.....:|....|::.|::..:.|:|:.|.|   .|...
Zfish    27 FWGPVANWGLPIAAISD-MKKSPEIISGRMTFALTCYSLLFMRFAYKVQPRNWLLFACHFTNEGA 90

  Fly   104 FLIQGYLMVKH 114
            .||||..::|:
Zfish    91 QLIQGSRLIKY 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 24/76 (32%)
mpc1NP_001002398.2 MPC 24..106 CDD:427425 24/76 (32%)

Return to query results.
Submit another query.