DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and CG9399

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001163571.1 Gene:CG9399 / 41157 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster


Alignment Length:134 Identity:69/134 - (51%)
Similarity:87/134 - (64%) Gaps:8/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            |.|.|..|||||..|...|||||..::|||..||||:|:|||||.|||.||.||||| |:||...
  Fly    22 SAGKGIHSKLYNGMIGAADKFVPAKLRPLWMHPAGPKTIFFWAPVFKWGLVAAGLSD-LARPADT 85

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRW-------RSENSRN 124
            ||::.|.:||.||:||||||:||.||||:|.|||:.|.:.|...:.:...:       :.|..:.
  Fly    86 ISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQVVQLARAYHYHQSQEKLKQEQQQP 150

  Fly   125 AVFN 128
            ||.|
  Fly   151 AVQN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 52/103 (50%)
CG9399NP_001163571.1 MPC 46..139 CDD:281629 51/93 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446529
Domainoid 1 1.000 106 1.000 Domainoid score I2184
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm42623
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - P PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
109.900

Return to query results.
Submit another query.