DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc-1

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_497894.2 Gene:mpc-1 / 259500 WormBaseID:WBGene00011119 Length:137 Species:Caenorhabditis elegans


Alignment Length:91 Identity:27/91 - (29%)
Similarity:40/91 - (43%) Gaps:11/91 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLI 106
            ||.|...|.|.||.|.| |.:.|..||.....:|.:...::.|::..:.|:|..|.|.:.|.|..
 Worm    29 FWGPVANWGLPLAALGD-LKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNLLLFACHFANFSA 92

  Fly   107 QGYLMVKHLRWRSENSRNAVFNHSHY 132
            ||          ::..|....|:.||
 Worm    93 QG----------AQLGRFVNHNYLHY 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 23/80 (29%)
mpc-1NP_497894.2 MPC 11..112 CDD:427425 27/91 (30%)

Return to query results.
Submit another query.