DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and MPC2

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001137146.1 Gene:MPC2 / 25874 HGNCID:24515 Length:127 Species:Homo sapiens


Alignment Length:100 Identity:49/100 - (49%)
Similarity:64/100 - (64%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANIS 68
            |...|...|:..:..::..:|..::||:..||||||||||||..||.||.|||:| ::||...:|
Human     5 GARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLAD-MARPAEKLS 68

  Fly    69 LNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAV 103
            ..|...|..||.||||||:||.|||::|.|||..|
Human    69 TAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 44/77 (57%)
MPC2NP_001137146.1 MPC 27..125 CDD:397629 44/77 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.