DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and SPAC24B11.09

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_592846.1 Gene:SPAC24B11.09 / 2541475 PomBaseID:SPAC24B11.09 Length:118 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:38/93 - (40%)
Similarity:59/93 - (63%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYN 95
            |..||||:||.|||||.||:|||:|:.| .:|.|..:|:.|..:|..||.||:|:|:::.||||.
pombe    10 WNHPAGPKTVHFWAPAMKWTLVLSGIGD-YARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYF 73

  Fly    96 LLAVNIAVFLIQGYLMVKHLRWRSENSR 123
            ...||..:.::....:.:.|.::.:..|
pombe    74 NATVNFFLAIVGAVQVSRILVYQRQQKR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 37/91 (41%)
SPAC24B11.09NP_592846.1 MPC 5..109 CDD:281629 38/93 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I1699
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1603
OMA 1 1.010 - - QHG57740
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm47050
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.