DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc1

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_587737.1 Gene:mpc1 / 2539169 PomBaseID:SPCC1235.11 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:91 Identity:27/91 - (29%)
Similarity:45/91 - (49%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLL---AVNIAV 103
            ||.|...:.:.:|.:.| |.:.|..||....|:|.:...::.||:.:::|:||.||   |.|..|
pombe    37 FWGPLSNFGIPIAAILD-LKKDPRLISGRMTGALILYSSVFMRYAWMVSPRNYLLLGCHAFNTTV 100

  Fly   104 FLIQGYLMVKHLRWRSENSRNAVFNH 129
            ...||...|.....:...|:.:||.:
pombe   101 QTAQGIRFVNFWYGKEGASKQSVFEN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 24/83 (29%)
mpc1NP_587737.1 MPC 28..131 CDD:427425 27/91 (30%)

Return to query results.
Submit another query.