DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc-2

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_491234.1 Gene:mpc-2 / 171957 WormBaseID:WBGene00018765 Length:133 Species:Caenorhabditis elegans


Alignment Length:132 Identity:54/132 - (40%)
Similarity:72/132 - (54%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GPLSKLYNITISTIDKFV----PGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            ||...||.......||||    |...:|.|...|||:|||||||..||:|:.|||:| |:||...
 Worm     2 GPHRLLYQALCKAGDKFVYPVLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLAD-LARPADK 65

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFL--IQGYLMVKHLRWRSENSRNAVFNH 129
            :||.|..:|..||.||:||.:||||.||.|.:||..|..  :.....:.|.|:::.:........
 Worm    66 LSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIAHYRYQNPDWETKEIME 130

  Fly   130 SH 131
            :|
 Worm   131 TH 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 44/98 (45%)
mpc-2NP_491234.1 MPC 31..130 CDD:281629 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158659
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm14551
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.