DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and Mpc1

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_321716.4 Gene:Mpc1 / 1281759 VectorBaseID:AGAMI1_014331 Length:118 Species:Anopheles gambiae


Alignment Length:76 Identity:21/76 - (27%)
Similarity:37/76 - (48%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLLA---VNIAV 103
            ||.|...|.:.:|.|.| |.:.|..||....|:|.:..:::.|::..:.|:|..|.|   .|...
Mosquito    26 FWGPVANWGIPIAALGD-LKKDPKIISGTMTGALCLYSMVFMRFAWKVQPRNLLLFACHITNTTA 89

  Fly   104 FLIQGYLMVKH 114
            ..:||...:::
Mosquito    90 QALQGARFIEY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 21/76 (28%)
Mpc1XP_321716.4 MPC 23..114 CDD:427425 21/76 (28%)

Return to query results.
Submit another query.