DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic3 and DNAI1

DIOPT Version :9

Sequence 1:NP_001285482.2 Gene:Sdic3 / 318231 FlyBaseID:FBgn0052823 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001268357.1 Gene:DNAI1 / 27019 HGNCID:2954 Length:703 Species:Homo sapiens


Alignment Length:548 Identity:123/548 - (22%)
Similarity:234/548 - (42%) Gaps:81/548 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KQP--------LNLSVYNVQATNIPPKETLVYTKQTQTTSTGGGNGDVLAFDAQGDDEESSLQNL 77
            |||        .|.|....|..|.|.::....|:....|:..........:||..::.|..    
Human   185 KQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQ---- 245

  Fly    78 GNGFTSKLPPGYLTHGLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVR 142
                             ...|:...|.||:..|......:::..:..:...:|.||:        
Human   246 -----------------EKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQ-------- 285

  Fly   143 AGRVIERALSENV--DIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHF 205
            |.:::||.:::|.  ||..|:....|:.:...::....|.|.:...|:  :|...:|::.|:..:
Human   286 AAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDK--AKRLSVTALCWNPKY 348

  Fly   206 PELVV---GSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTY 267
            .:|..   |||...::|    .|::::::.| ..|.||.:|...|.||.......:|.|:..|.|
Human   349 RDLFAVGYGSYDFMKQS----RGMLLLYSLK-NPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHY 408

  Fly   268 SGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMVG---TQNAHNVISISSDGKLCSWSL--- 326
            .|.:.:::.:.....|...:...:..|:.||:.::...   .||. |..|:||||::.||:|   
Human   409 DGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNL-NFFSVSSDGRIVSWTLVKR 472

  Fly   327 -----DM--LSQPQDTLELQQRQSKAIAITSMAFPAN-EINSL-VMGSEDGYVYSASRHGLRSGV 382
                 |:  |.....|.|:.:...........||..: ||:.: ::|:|:|.:|..|: ...|..
Human   473 KLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSK-SYSSQF 536

  Fly   383 NEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWS 447
            .:.|:.|...:..:|     .:|....:|::.|.|||:|:|......|::.::.|| .|.||||:
Human   537 LDTYDAHNMSVDTVS-----WNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNS-AVGDVAWA 595

  Fly   448 PVHPALFAAVDGSGRLDLWNLNQDTEVPIASIVVAGAPALNRVSWTPSGL-H--VCIGDEAGKLY 509
            |....:||||...|:..:::|..:....|.:..||...  ||::.....| |  :.:||:.|.:.
Human   596 PYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKK--NRLTHVQFNLIHPIIIVGDDRGHII 658

  Fly   510 VYDVAENLAQPSRD----EIKMNQSDEV 533
            ...::.||.:..::    |::...:.|:
Human   659 SLKLSPNLRKMPKEKKGQEVQKGPAVEI 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic3NP_001285482.2 Dynein_IC2 23..51 CDD:288403 7/35 (20%)
NtpH 108..>178 CDD:225368 12/71 (17%)
WD40 196..512 CDD:295369 86/336 (26%)
WD40 repeat 196..245 CDD:293791 13/51 (25%)
WD40 <224..523 CDD:225201 81/316 (26%)
WD40 repeat 251..289 CDD:293791 6/37 (16%)
WD40 repeat 298..337 CDD:293791 15/51 (29%)
WD40 repeat 349..435 CDD:293791 22/87 (25%)
WD40 repeat 441..479 CDD:293791 13/37 (35%)
WD40 repeat 487..513 CDD:293791 7/28 (25%)
DNAI1NP_001268357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..174
WD40 324..681 CDD:225201 93/373 (25%)
WD 1 324..374 12/55 (22%)
WD40 repeat 339..385 CDD:293791 12/50 (24%)
WD40 <357..615 CDD:295369 72/270 (27%)
WD 2 379..417 11/37 (30%)
WD40 repeat 391..428 CDD:293791 7/36 (19%)
WD 3 426..469 13/43 (30%)
WD40 repeat 439..496 CDD:293791 16/57 (28%)
WD 4 478..530 12/51 (24%)
WD40 repeat 504..541 CDD:293791 10/37 (27%)
WD 5 535..574 11/43 (26%)
WD40 repeat 547..584 CDD:293791 10/41 (24%)
WD 6 578..616 14/38 (37%)
WD40 repeat 589..616 CDD:293791 11/26 (42%)
WD 7 622..662 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.