DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic3 and Dync2i1

DIOPT Version :9

Sequence 1:NP_001285482.2 Gene:Sdic3 / 318231 FlyBaseID:FBgn0052823 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006515843.1 Gene:Dync2i1 / 217935 MGIID:2445085 Length:1033 Species:Mus musculus


Alignment Length:610 Identity:125/610 - (20%)
Similarity:216/610 - (35%) Gaps:164/610 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TYSTLSGGKKQPLNLSVYNVQATNIPPKETLVYTKQTQTTSTGGGNGDVLAFDAQGDDEESS--- 73
            |:|.|.   ..|:|  .|::...|...|.    |||.....    |.|.:..|.|.:|.|:.   
Mouse   481 TFSLLD---LPPVN--EYDMYIRNFGKKN----TKQAYVQY----NEDNVERDIQTEDIETREVW 532

  Fly    74 LQNLGNGFTSKLPPGYLTHGLPTVKD-----VAPAI-TPLEIKKETEVKKEVNELSEEQKQMIIL 132
            .|:.|.|..        ..|....||     |.|.| ||                          
Mouse   533 TQHPGEGTA--------VSGGSEEKDFSDVTVVPKIDTP-------------------------- 563

  Fly   133 SENFQRFVVRAGRVIERALSENVDIYTDYIGGGDS-------EEANDERSHARLSLNRVFYDERW 190
              ....|:..|.:|:...|.|      |.:..|.|       :..|...|.::|:.:..|...| 
Mouse   564 --RLANFLRAACQVVAVLLEE------DRLAAGPSWIPRAQDKALNISDSSSQLNTSLPFLQSR- 619

  Fly   191 SKNRCITSMDWSTHFPELVVGSYHNNEESPNEPD----GVVMVWNTKFKKSTPEDVFHCQSAVMS 251
             |..|:    .::......|.|.|:..|....|.    .::.||:. ::.|.|:.|..|:|.|..
Mouse   620 -KVSCL----HASRVQRQTVVSVHDLPEKAFAPSLDSRHLLCVWDI-WQPSGPQKVLICESKVTC 678

  Fly   252 TCFAKFNPNLILGGTYSGQIVLWDNR-------------------------------VQKRTPIQ 285
            .||:.....|:..||..|.:|:||.|                               |..|:|:|
Mouse   679 CCFSPLKAFLLFAGTVHGSVVVWDLREDSRIHHYVRLSNCFWAFRTPTFSTDGILTSVNHRSPLQ 743

  Fly   286 R-TPLSAAAHTHPVYCLQMVGTQN-----AHNVISISSDGKLCSW------SLDMLSQPQD---- 334
            . .|::.:|:....:.|....||.     :.::.|:...|.|..|      ..|:.....|    
Mouse   744 AIEPVATSAYKKQSFVLSPFSTQEEMAGLSFHIASLDETGVLNVWVVVELPKADISGSMSDLGLI 808

  Fly   335 ----------TL-----ELQQRQSKAIAIT---SMAFPANEINSLVMGSEDGYVYSASRHGLRSG 381
                      |:     .|..:.|:....|   |:.|..::.|..|:|::.|.:..::|...|..
Mouse   809 PGGRIKLVHSTVIQLGNSLSHKDSELWGSTQTLSVKFLPSDPNHFVVGTDMGLISHSTRQDWRVS 873

  Fly   382 VNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSD--YVMDV 444
             ..|::.....:..|..:....||....:||....|.:|:|..|...:|:..:::::.  .|..:
Mouse   874 -PRVFKPEQHGVRPIKVNVIDFSPFEETVFLAGCSDGSIRLHQLTSERPIMQWDNSTSGHAVTSL 937

  Fly   445 AWSPVHPALFAAVDGSGRLDLWNLNQDTEVPIA----------SIVVAGAPALNRVSWTPSGLHV 499
            .|||..||:|...|.:.|:.:|:|.::...|:|          ::.:.|.|.....|:    :.:
Mouse   938 QWSPTRPAVFLVQDDASRIYVWDLLENDLGPVAQQPISPDKLVAMTIVGEPEKTSGSF----VAL 998

  Fly   500 CIGDEAGKLYVYDVAENLAQPSRDE 524
            .:...:|.:.|.::......|:.||
Mouse   999 VLARTSGTVDVQNLKRRWTTPAVDE 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic3NP_001285482.2 Dynein_IC2 23..51 CDD:288403 8/27 (30%)
NtpH 108..>178 CDD:225368 10/76 (13%)
WD40 196..512 CDD:295369 79/396 (20%)
WD40 repeat 196..245 CDD:293791 10/52 (19%)
WD40 <224..523 CDD:225201 75/379 (20%)
WD40 repeat 251..289 CDD:293791 14/69 (20%)
WD40 repeat 298..337 CDD:293791 10/68 (15%)
WD40 repeat 349..435 CDD:293791 20/88 (23%)
WD40 repeat 441..479 CDD:293791 13/47 (28%)
WD40 repeat 487..513 CDD:293791 3/25 (12%)
Dync2i1XP_006515843.1 PTZ00121 <48..396 CDD:173412
WD40 604..1000 CDD:225201 83/407 (20%)
WD40 repeat 635..671 CDD:293791 9/36 (25%)
WD40 repeat 676..708 CDD:293791 11/31 (35%)
WD40 repeat 715..752 CDD:293791 5/36 (14%)
WD40 repeat 759..788 CDD:293791 6/28 (21%)
WD40 repeat 842..878 CDD:293791 9/36 (25%)
WD40 repeat 890..926 CDD:293791 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.