DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32820 and Tektin-C

DIOPT Version :9

Sequence 1:NP_728441.1 Gene:CG32820 / 318228 FlyBaseID:FBgn0052820 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001097520.2 Gene:Tektin-C / 38653 FlyBaseID:FBgn0035638 Length:421 Species:Drosophila melanogaster


Alignment Length:427 Identity:110/427 - (25%)
Similarity:200/427 - (46%) Gaps:17/427 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IFPNL----VTGFDRNPQHAARAA-LYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMR 242
            :.|||    ::|.....:|....| ...||:..:|..||..|:..:.....|:||:..::.|::.
  Fly     1 MLPNLKSRRISGLQLAGKHLGPVAKCPPRYSEEDWDYNNKIKFRITCDQEKLAERIVEESRRVVD 65

  Fly   243 ETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQ---CGKALLDLEIP 304
            ||.:...:.||:....:.||.:::.|..:|||.:.:....|...:|..:.:   |.:.|.|..  
  Fly    66 ETKDTTKNWQREVEHHMRERTSEIRFLVDELNRQKKTAALEDEALNTYRNRVLNCIEFLKDKS-- 128

  Fly   305 LHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLED 369
            |.|.::||..||.|.|.:...|.|:::|..|:..::..:.......::..:|....|.|.:||:.
  Fly   129 LAICKQCLILREGRIGVDLCDDEVDRSLRRELKVIKGCQGLADAALKEAEEQIRKLRAAIYLLDQ 193

  Fly   370 DVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQL 434
            |::.|:.||.||....:|......:.....:.|.....|..| |...:.|::..:........||
  Fly   194 DLAAKDKSLAIDEKNLKLKEFQHDLAKGQDLSKQHCQFSLTE-WQAQTYENLEANAKALVSAGQL 257

  Fly   435 RSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAI 499
            |:....::..|...:.:....||.||:||..|....|..::...:.....:..:::::..|:|.:
  Fly   258 RAYIDLLLKQVCEDMQNQTDRTNEAFERRISETKHVKQCLENKHKDTMDHIHQVQRNMTELEKEM 322

  Fly   500 QDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKT 564
            .||...:.:.||||..|:||.|:||..|..||.|..|:|.::.:|..|:.||.|.:|:.:.|:..
  Fly   323 MDKQRAITLCQTRLSNRAHRPGLELTCDMVQDALYNELQALKASVCKLNQKLNENKASMRYLMHV 387

  Fly   565 RCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIKY 601
            :...|.::..|.|...||...||:||::      :||
  Fly   388 QVMQEEEINIKANTCKIDEVDCMTLRQA------LKY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32820NP_728441.1 Tektin 212..591 CDD:281184 99/381 (26%)
Tektin-CNP_001097520.2 Tektin 35..417 CDD:397319 100/390 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000711
OrthoInspector 1 1.000 - - otm14718
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.